DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and CG9400

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster


Alignment Length:275 Identity:86/275 - (31%)
Similarity:125/275 - (45%) Gaps:38/275 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LIC---LAIFQLIFQLIL----AKDYSWCDPDLCG--NG-----VRHIACRTTGNFHRRCQPDAV 55
            |.|   ||..|.:.:.|.    |....:|...||.  ||     |.|.||...|:|...|.|:..
  Fly    23 LACEKGLAGAQTLIETITTTTPASSGGYCAAALCELYNGTHLVHVPHTACGNNGSFSPACGPEPK 87

  Fly    56 QVDVS-RHKADFLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCH 119
            .:::| |.:...|..||..|:.:|.|.:.||..||.|..:.||.||:.::.|:.:.|:..||.|.
  Fly    88 LLEMSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCR 152

  Fly   120 NTYRYANSGQNLCAVW----------RPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTP 174
            ||.|:..||||:...|          |.:|..:|           ||.|....:.||||.:...|
  Fly   153 NTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVIN-----------WFREHQDANQSFIDRYHPHP 206

  Fly   175 IFEDYGHFAELSVDKNFAVGCSIMRFTRPDYPSVYIYNFICNYASLYALGAPVYETGRAASRCTT 239
            ..:..|||..|..|:...|||:.:||..|. .:.:.:...|||........|:|::|.|.|:|..
  Fly   207 QGKKIGHFTLLVSDRVNRVGCAGVRFLEPK-SNRFQFMLTCNYDYNNIFNEPIYQSGPAGSKCPQ 270

  Fly   240 GK-SHFYPGLCSTRE 253
            .: |..:|.||..|:
  Fly   271 HRISEKFPSLCDWRD 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 52/164 (32%)
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 52/164 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440671
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
88.010

Return to query results.
Submit another query.