DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and Crispld1

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001128435.1 Gene:Crispld1 / 316482 RGDID:1564813 Length:500 Species:Rattus norvegicus


Alignment Length:188 Identity:52/188 - (27%)
Similarity:77/188 - (40%) Gaps:43/188 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LHAHNKRRNFLALGKVPGYYPAA-RMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANSGQN 130
            |..|||.|:.:        |||| .|..|.||.||:..:.....||..:|..   |....:.|||
  Rat    66 LDLHNKLRSQV--------YPAASNMEYMTWDVELERSAESWAETCLWEHGP---TSLLPSIGQN 119

  Fly   131 LCAVW---RPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPI--FEDYG----HFAELS 186
            |.|.|   ||.:.||..          |::|  :.|.|:....:..|.  |...|    |:.::.
  Rat   120 LGAHWGRYRPPTFHVQA----------WYDE--VRDFSYPYEHECDPYCPFRCSGPVCTHYTQVV 172

  Fly   187 VDKNFAVGCSI-----MRFTRPDYP-SVYIYNFICNYASL-YALGAPVYETGRAASRC 237
            ...:..:||:|     |......:| :||:   :|||:.. ...|...|:.|:..|.|
  Rat   173 WATSSRIGCAINLCHNMNIWGQIWPKAVYL---VCNYSPKGNWWGHAPYKHGKPCSAC 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 46/166 (28%)
Crispld1NP_001128435.1 SCP_euk 63..207 CDD:240180 46/166 (28%)
LCCL 291..375 CDD:128866
LCCL 394..492 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344630
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.