DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and Pi15

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001100387.1 Gene:Pi15 / 301489 RGDID:1309577 Length:258 Species:Rattus norvegicus


Alignment Length:203 Identity:56/203 - (27%)
Similarity:83/203 - (40%) Gaps:51/203 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANSGQNL 131
            |..||:.|     |||  :.|||.|..||||:.|...:.....||..||..   :|.....||||
  Rat    71 LDYHNQVR-----GKV--FPPAANMEYMVWDENLAKSAEAWAATCIWDHGP---SYLLRFLGQNL 125

  Fly   132 CA-VWRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIFED---------YG----HF 182
            .. ..|.||    :..||:.    |::|  :.|.:|       |..:|         :|    |:
  Rat   126 SVRTGRYRS----ILQLVKP----WYDE--VKDYAF-------PYPQDCNPRCPMRCFGPMCTHY 173

  Fly   183 AELSVDKNFAVGCSIMRFTRPD-YPSVY---IYNFICNYASL-YALGAPVYETGRAASRCTTGKS 242
            .::....:..:||:|......: :.||:   :| .:||||.. ..:|...|:.|...|.|...  
  Rat   174 TQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVY-LVCNYAPKGNWIGEAPYKVGVPCSSCPPS-- 235

  Fly   243 HFYPGLCS 250
              |.|.|:
  Rat   236 --YGGACT 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 46/168 (27%)
Pi15NP_001100387.1 SCP_euk 69..212 CDD:240180 46/168 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344672
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.