DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and Pi16

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001163952.1 Gene:Pi16 / 294312 RGDID:1304760 Length:483 Species:Rattus norvegicus


Alignment Length:184 Identity:45/184 - (24%)
Similarity:69/184 - (37%) Gaps:29/184 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 KADFLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANS 127
            |...:..||..|..::    |   ||:.|..|.|||||...:....:.|...    ||..| ...
  Rat    39 KQTMVELHNHYRAQVS----P---PASDMLQMRWDDELAAFAKAYAQKCVWG----HNKER-GRR 91

  Fly   128 GQNLCAVWRPRSPHVNVTSLVEECLGLWFNEFDL--IDSSFIDSFKVTPIFEDYGHFAELSVDKN 190
            |:||.|:       .:....|...:|.|..|.:.  :.::..|..::.      ||:.::...|.
  Rat    92 GENLFAI-------TDEGMDVPLAVGNWHEEHEYYNLSTATCDPGQMC------GHYTQVVWSKT 143

  Fly   191 FAVGC-SIMRFTRPDYPSVYIYNFICNYASL-YALGAPVYETGRAASRCTTGKS 242
            ..:|| |....|........|:..:|||... ...|...|:.|...|:|..|.|
  Rat   144 ERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYS 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 37/157 (24%)
Pi16NP_001163952.1 SCP_HrTT-1 39..172 CDD:240186 37/157 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.