Sequence 1: | NP_611582.1 | Gene: | CG17974 / 37441 | FlyBaseID: | FBgn0034624 | Length: | 259 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_775890.2 | Gene: | CLEC18C / 283971 | HGNCID: | 28538 | Length: | 446 | Species: | Homo sapiens |
Alignment Length: | 213 | Identity: | 46/213 - (21%) |
---|---|---|---|
Similarity: | 71/213 - (33%) | Gaps: | 35/213 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 QPDAVQVDVSRHKADF--LHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKL 113
Fly 114 DHDD-CHNTYRYANSGQNLCAVWRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIFE 177
Fly 178 DYGHFAELSVDKNFAVGCSIMRFTRPDYPSVYIYNFICNYA---SLYALGAPV--YETGRAASRC 237
Fly 238 TTGKSHFYP------GLC 249 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17974 | NP_611582.1 | SCP_euk | 63..218 | CDD:240180 | 33/157 (21%) |
CLEC18C | NP_775890.2 | SCP_euk | 50..183 | CDD:240180 | 31/153 (20%) |
CLECT | 310..434 | CDD:153057 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165151089 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2340 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.840 |