DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and GLIPR1L1

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_011536436.2 Gene:GLIPR1L1 / 256710 HGNCID:28392 Length:301 Species:Homo sapiens


Alignment Length:186 Identity:51/186 - (27%)
Similarity:79/186 - (42%) Gaps:44/186 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LHAHNKRRNFLALGKV-PGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDD-------CHNTYR 123
            :.|||:.|     ||| |   |||.|..|:||..|..::......||.:|:|       |:..:.
Human   123 IEAHNEWR-----GKVNP---PAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFE 179

  Fly   124 YANSGQNLCAVW----RPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIFEDYGHFAE 184
            |.  |:|   :|    :..:|...:|:        |:||....|...:...:|.      ||:.:
Human   180 YV--GEN---IWLGGIKSFTPRHAITA--------WYNETQFYDFDSLSCSRVC------GHYTQ 225

  Fly   185 LSVDKNFAVGCSIMRFTRPDYPSVYIYNFICNY--ASLYALGAPVYETGRAASRCT 238
            |....:|.|||::...  |:........|:|||  |..:| ..|.|..|.:.|.|:
Human   226 LVWANSFYVGCAVAMC--PNLGGASTAIFVCNYGPAGNFA-NMPPYVRGESCSLCS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 44/164 (27%)
GLIPR1L1XP_011536436.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151303
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5261
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.