DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and CG30486

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster


Alignment Length:265 Identity:80/265 - (30%)
Similarity:120/265 - (45%) Gaps:24/265 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LICLAIFQLIFQLILAKDYSWCDPDLCGNGVRHIACRTTGNFHRRCQPDAVQVDVSRH-KADFLH 68
            |:.:.|..||.|..|:.||  |:.|||...:.|||||..|:|...|..:|:.:....| :|..|.
  Fly     4 LLSVLIIVLISQEALSTDY--CNKDLCLPEITHIACRNYGDFDESCGSEAIIMKFPMHMRAHLLA 66

  Fly    69 AHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNT-------YRYAN 126
            ..|..||.:|.|:.|...||:||||:.|.:||..|:....|.|....|.|.||       |.|.:
  Fly    67 VLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYVSYIYGS 131

  Fly   127 SGQNLCAVW--RPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIFEDYGHFAELSVDK 189
            :      .|  ..:.|    .|:::..|..|.::......:.|::.|.....:..|:|.:|..|.
  Fly   132 T------KWLQLEKDP----ISVLDFVLQFWMDDVKGCTMAHINAEKPAKDGQCRGYFTQLVQDL 186

  Fly   190 NFAVGCSIMRFTRPDYPSVYIYNFICNYASLYALGAPVYE-TGRAASRCTTGKSHFYPGLCSTRE 253
            ...|||::| ..:.....:|.|..:|:::........||. :....|||..|....|.||||..|
  Fly   187 AAHVGCAMM-LRKGQTSGLYQYGVLCHFSRGKIANELVYRASAHPGSRCYAGTHSIYEGLCSPEE 250

  Fly   254 VYDPN 258
            ..:||
  Fly   251 HVNPN 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 44/163 (27%)
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 44/163 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440606
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.