DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and Crisp2

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001191000.1 Gene:Crisp2 / 22024 MGIID:98815 Length:243 Species:Mus musculus


Alignment Length:206 Identity:41/206 - (19%)
Similarity:71/206 - (34%) Gaps:48/206 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 QVDVSRHKADFLHAHNK-RRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCH 119
            |:.|.|   :.::.||: ||:....|        :.:..|.|..:....:......|.|:|....
Mouse    34 QLQVQR---EIVNKHNELRRSVNPTG--------SDILKMEWSIQATTNAQKWANKCILEHSSKD 87

  Fly   120 NTYRYANSGQNLCAVWRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIFEDYGHFAE 184
            :.......|:||.....|        :|....:..|:||    :..|:......| ....||:.:
Mouse    88 DRKINIRCGENLYMSTDP--------TLWSTVIQSWYNE----NEDFVYGVGAKP-NSAVGHYTQ 139

  Fly   185 LSVDKNFAVGCSIMRFTRPDYPSVYIYNFICNYASL----------YALGAPVYETGRAASRCTT 239
            |....:|.:||.|......|...   |.::|:|..:          |..|.|          |.:
Mouse   140 LVWYSSFKIGCGIAYCPNQDNLK---YFYVCHYCPMGNNVMKKSTPYQQGTP----------CAS 191

  Fly   240 GKSHFYPGLCS 250
            ..::...|||:
Mouse   192 CPNNCENGLCT 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 30/155 (19%)
Crisp2NP_001191000.1 SCP_CRISP 36..171 CDD:240183 33/161 (20%)
Crisp 189..243 CDD:285731 4/14 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841359
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.