DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and scl-21

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_507793.1 Gene:scl-21 / 189870 WormBaseID:WBGene00012816 Length:198 Species:Caenorhabditis elegans


Alignment Length:221 Identity:47/221 - (21%)
Similarity:75/221 - (33%) Gaps:57/221 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IACRTTGNFHRRCQPDAVQVDVSRHKADFLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQY 102
            |.|....:.|.:....| |.::..:..|.......||..|....|....||:.|..|.|:..|..
 Worm     6 IFCLAAVSVHAQFSASA-QKEIVTYINDLRSLVASRRFHLDSRDVETLPPASDMLKMTWNSTLAV 69

  Fly   103 LSMLNTRTCKLDHDDCHNTYRYANSGQNLCAVWRPRSPHV--------NVTSLVEECLGLWFN-- 157
            .:....:||                   ..|| ...||.:        ||.::.:..||.|.:  
 Worm    70 AAQKLAKTC-------------------FIAV-ESSSPGIADKRIVAANVVTVAKNALGHWKHSL 114

  Fly   158 --EFDL--IDSSFIDSFKVTPIFEDYGHFAELSVDKNFAVGCSIMRFTRP---DYPSVYIYNFIC 215
              |::|  .:|::|.              .:|...|:.:|||..    .|   |......|..:|
 Worm   115 NKEWNLKSYNSNYIG--------------IQLIWAKSSSVGCGF----SPCEIDSQGRRWYKVVC 161

  Fly   216 NYASLYAL-GAPVYETGRAASRCTTG 240
            ::.....: ..|||:.|:|...|..|
 Worm   162 SFEKKGGITREPVYKKGKACEACPAG 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 35/171 (20%)
scl-21NP_507793.1 CAP_euk 23..163 CDD:349399 36/177 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.