Sequence 1: | NP_611582.1 | Gene: | CG17974 / 37441 | FlyBaseID: | FBgn0034624 | Length: | 259 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_502532.1 | Gene: | scl-14 / 184246 | WormBaseID: | WBGene00008625 | Length: | 208 | Species: | Caenorhabditis elegans |
Alignment Length: | 201 | Identity: | 46/201 - (22%) |
---|---|---|---|
Similarity: | 71/201 - (35%) | Gaps: | 31/201 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 63 KADFLHAHNKRRN------FLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDC--- 118
Fly 119 -HNTYRYANSGQNLCAVWRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIFED-YGH 181
Fly 182 FAELSVDKNFAVGCSIMRFTRPDYPSVYIYNFICNY--ASLYALGAPVYETGRAASRCTTGKS-H 243
Fly 244 FYPGLC 249 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17974 | NP_611582.1 | SCP_euk | 63..218 | CDD:240180 | 35/167 (21%) |
scl-14 | NP_502532.1 | SCP | 22..175 | CDD:214553 | 35/166 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 41 | 1.000 | Domainoid score | I8510 |
eggNOG | 1 | 0.900 | - | - | E1_COG2340 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 71 | 1.000 | Inparanoid score | I3895 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10334 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.970 |