DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and scl-26

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_504963.1 Gene:scl-26 / 183662 WormBaseID:WBGene00016821 Length:208 Species:Caenorhabditis elegans


Alignment Length:217 Identity:45/217 - (20%)
Similarity:70/217 - (32%) Gaps:74/217 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 HNKRRNFLALGKVPGYYPAARMATMVW-------DDELQYLSMLNTRTCKLDHD--DCHN-TYRY 124
            |||.||..:.|              :|       ..::|.|...|:...:..|:  ||.. ..|.
 Worm    34 HNKLRNDASQG--------------LWARHNISKSTDMQKLFWNNSLVAEAKHEMYDCDQLEKRE 84

  Fly   125 ANSGQNLCAVWRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIFEDYGHFAELSVD- 188
            ...|:|:                         .::|:.....:|..:.........|.|..|.| 
 Worm    85 LTLGENI-------------------------YQYDVTTYDDVDGQQGEAAINKDSHDALSSKDQ 124

  Fly   189 ------------KNFAVGCSIMRFTRPD-----YPSVYIYNFICNYA-SLYALGAPVYETG-RAA 234
                        |:.::||......|.|     |.:.:|   ||.|: :|..:...:||.| .|.
 Worm   125 AAQYRLRQILYSKSNSIGCIYESCDRIDDEGTNYNTRFI---ICKYSPALKNIDDQLYEEGEEAC 186

  Fly   235 SRCTTGKSHFYP--GLCSTREV 254
            |.|.:|.|...|  .||..:.|
 Worm   187 SNCPSGTSCTDPMMKLCEKKLV 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 31/175 (18%)
scl-26NP_504963.1 CAP_euk 30..168 CDD:349399 31/175 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.