DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and scl-8

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_502510.1 Gene:scl-8 / 183345 WormBaseID:WBGene00008030 Length:210 Species:Caenorhabditis elegans


Alignment Length:197 Identity:42/197 - (21%)
Similarity:70/197 - (35%) Gaps:18/197 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 KADFLHAHNKRRNFLALG----KVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYR 123
            |...|:|||..|:.:|.|    |......|..|..|.||..|:..:......|.:.|.....|. 
 Worm    23 KQSILNAHNDIRSRIAKGNYVAKGNRKESATNMLKMKWDSSLEQSAQNYANGCHMQHSTNDKTI- 86

  Fly   124 YANSGQNLCAVWRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIFEDYGHFAELSVD 188
                |:||...| ...|..::....:.....|.:||:....: .:.|.:........|..:::..
 Worm    87 ----GENLYWEW-SGDPFSDLDKFGKIATVAWDHEFEQFGWN-SNKFSLALFNTGVAHATQIAWA 145

  Fly   189 KNFAVGCSIMRFTR-PDYPSVYIYNFICNY---ASLYALGAPVYETGRAASRCTTGKS-HFYPGL 248
            ....:||.:....| .....::....:|.|   .:.:...  :|.:|...|.|..|.| ....||
 Worm   146 PTGKIGCGVKNCGRDARRGGLFQVAIVCQYRVRGNFFFKN--IYNSGATCSACPAGTSCEQSTGL 208

  Fly   249 CS 250
            |:
 Worm   209 CA 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 33/162 (20%)
scl-8NP_502510.1 SCP 22..175 CDD:214553 32/158 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.