DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and vap-1

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001024553.1 Gene:vap-1 / 181768 WormBaseID:WBGene00006886 Length:424 Species:Caenorhabditis elegans


Alignment Length:243 Identity:59/243 - (24%)
Similarity:86/243 - (35%) Gaps:40/243 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SWCDPDLCGNGVRHIACRTTGNFHRRCQPDAVQVDVSRHKADFLHAHNKRRNFLALGKVPGYYPA 88
            |.|...||....:.....|    ...|.....|.|.:|.  :||..|||.|..||.|.......|
 Worm   203 SQCKNGLCYKAPQAPVVET----FTMCPSVTDQSDQARQ--NFLDTHNKLRTSLAKGLEADGIAA 261

  Fly    89 ARMATMVWD-DELQYLSML--NTRT----CKLDHDDCHNTYRYANSGQNLCAVWRPRSPHVNVTS 146
            ...|.|... .:|:|...:  |.||    |...|.   .:.:....|:||..:.....|.:..  
 Worm   262 GAFAPMAKQMPKLKYSCTVEANARTWAKGCLYQHS---TSAQRPGLGENLYMISINNMPKIQT-- 321

  Fly   147 LVEECLGLWFNEF-DLIDSSFIDSFKVTPIFE-DYGHFAELSVDKNFAVGCSIMRFTRPDYPSVY 209
             .|:....|::|. |....|  |:.....:|: ..||:.:::.:....:||.:.......| ||.
 Worm   322 -AEDSSKAWWSELKDFGVGS--DNILTQAVFDRGVGHYTQMAWEGTTEIGCFVENCPTFTY-SVC 382

  Fly   210 IYNFICNYAS--LYALGAPVYETGRAASRCTTGKSHFYPG--LCSTRE 253
            .|....||.:  :|..|:|          ||....  .||  .||..|
 Worm   383 QYGPAGNYMNQLIYTKGSP----------CTADAD--CPGTQTCSVAE 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 39/163 (24%)
vap-1NP_001024553.1 SCP 31..175 CDD:214553
SCP 234..386 CDD:214553 39/162 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.