DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and Crispld2

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_612527.2 Gene:Crispld2 / 171547 RGDID:620860 Length:497 Species:Rattus norvegicus


Alignment Length:207 Identity:51/207 - (24%)
Similarity:82/207 - (39%) Gaps:41/207 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 KADFLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANS 127
            :.:.|..|||.|     |:|  |.||:.|..|.||:||:..:....:.|..:|....   ...:.
  Rat    56 RQEILMLHNKLR-----GQV--YPPASNMEYMTWDEELERSAAAWAQRCLWEHGPAS---LLVSI 110

  Fly   128 GQNLCAVW-RPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIFED------YGHFAEL 185
            ||||...| |.|||..:|.|        |::|  :.|.::....:..|...:      ..|:.::
  Rat   111 GQNLAVHWGRYRSPGFHVQS--------WYDE--VKDYTYPYPHECNPWCPERCSGAMCTHYTQM 165

  Fly   186 SVDKNFAVGCSIMRFTRPDY------PSVYIYNFICNYASL-YALGAPVYETGRAASRCTTGKSH 243
            .......:||::........      .:||:   :|||:.. ..:|...|:.||..|.|.:.   
  Rat   166 VWATTNKIGCAVHTCRSMSVWGDIWENAVYL---VCNYSPKGNWIGEAPYKHGRPCSECPSS--- 224

  Fly   244 FYPGLCSTREVY 255
             |.|.|.....|
  Rat   225 -YGGGCRNNLCY 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 40/167 (24%)
Crispld2NP_612527.2 SCP_euk 56..201 CDD:240180 40/167 (24%)
LCCL 286..370 CDD:128866
LCCL 389..487 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344693
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.