DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and CRISP1

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001122.2 Gene:CRISP1 / 167 HGNCID:304 Length:249 Species:Homo sapiens


Alignment Length:227 Identity:46/227 - (20%)
Similarity:87/227 - (38%) Gaps:60/227 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RCQPDAVQVDVSRHKADFLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKL 113
            |.|.:.:..|:...:.:.::.||..|..:    ||   ||:.|..|.|.:|....:.:.::.|.:
Human    27 RDQFNKLVTDLPNVQEEIVNIHNALRRRV----VP---PASNMLKMSWSEEAAQNARIFSKYCDM 84

  Fly   114 DHDD-----CHNTYRYANSGQNLCAVWRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFK-- 171
            ...:     ..||:    .|:|:.....|    |:.:|::    |:|::|        ..|||  
Human    85 TESNPLERRLPNTF----CGENMHMTSYP----VSWSSVI----GVWYSE--------STSFKHG 129

  Fly   172 -VTPIFEDY--GHFAELSVDKNFAVGCSIMRFTRPDYPSVYIYNFICNYA----------SLYAL 223
             .|...:|.  .|:.::....::.:||:|....:...|.   |.::|:|.          ..|..
Human   130 EWTTTDDDITTDHYTQIVWATSYLIGCAIASCRQQGSPR---YLYVCHYCHEGNDPETKNEPYKT 191

  Fly   224 GAPVYETGRAASRCTTGKSHFYPGLCSTREVY 255
            |.|          |....|:....||:...:|
Human   192 GVP----------CEACPSNCEDKLCTNPCIY 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 34/164 (21%)
CRISP1NP_001122.2 SCP_CRISP 39..177 CDD:240183 35/167 (21%)
Crisp 195..249 CDD:285731 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151261
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.