DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and CG43777

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001261163.1 Gene:CG43777 / 14462631 FlyBaseID:FBgn0264299 Length:273 Species:Drosophila melanogaster


Alignment Length:281 Identity:63/281 - (22%)
Similarity:104/281 - (37%) Gaps:57/281 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IFQLIFQLILAKDYSWCDPDLCGNGVRHIACRTTGNFHRRCQPDAVQVDVSRHKADF-------- 66
            :..::..|.|...|::|      |...| .|......|..|           |..||        
  Fly     6 LLAVVLLLPLTSGYNYC------NNKTH-KCVLEKKKHFMC-----------HLKDFTVYGNSTK 52

  Fly    67 LHA---HNKRRNFLAL-------GKVPG----------YYPAARMATMVWDDELQYLSMLNTRTC 111
            .||   :|.|...:||       .|..|          :..|.||..:.||.||.|:...:..|.
  Fly    53 FHASVPNNMRMQKIALDILNNLRNKFAGGELRTKGNKTFAKARRMRQLFWDKELAYMGNNHASTL 117

  Fly   112 KLDHDDCHNTYRYANSGQNLCAVWRPRSPHVNVTSLVEECLGLWFNEFDLID--SSFIDSFKVTP 174
            .|....|.:|.|:.:.|:.:..| .||. .:|:..:..:.....|.|:..:.  .:.:.:|....
  Fly   118 SLKSSQCRSTLRFPHVGEAIALV-TPRE-KLNLKEIYSKAFTPMFAEYQHVSDPDALLHAFDPDR 180

  Fly   175 IFEDYGHFAELSVDKNFAVGCSIMRFTRPDYPSVYIYNFICNYASLYAL-GAPVYETGRAASRCT 238
            .|: ..||..:..|:...|||.:......: ||:...:|:..|...:.: |:.||:.|...|.|.
  Fly   181 DFQ-VRHFTNIISDRVSRVGCGVAVGANCN-PSIKFCHFLTCYFDFHNMAGSYVYKAGDPTSSCD 243

  Fly   239 ---TGKSHFYPGLC-STREVY 255
               ...|..|..|| ::.|::
  Fly   244 DWGVVSSDKYANLCKNSGEIF 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 41/184 (22%)
CG43777NP_001261163.1 SCP_euk 64..223 CDD:240180 36/162 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440670
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.