DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and R3HDML

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_848586.1 Gene:R3HDML / 140902 HGNCID:16249 Length:253 Species:Homo sapiens


Alignment Length:192 Identity:42/192 - (21%)
Similarity:62/192 - (32%) Gaps:56/192 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 YYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANSGQNLCAVWRPRSPHVNVTSLVE 149
            |.|||.|..||||..|...:......|...|.. ....||.  ||||       |.|......|.
Human    78 YPPAANMEYMVWDKRLARAAEAWATQCIWAHGP-SQLMRYV--GQNL-------SIHSGQYRSVV 132

  Fly   150 ECLGLWFNEFDLIDSSFIDSFKVTPIF----------------EDYGHFAELSVDKNFAVGCSIM 198
            :.:..|..|            |...:|                ....|:.::....:..:||:|.
Human   133 DLMKSWSEE------------KWHYLFPAPRDCNPHCPWRCDGPTCSHYTQMVWASSNRLGCAIH 185

  Fly   199 RFTRPDYPSVYIYN--------FICNYA-SLYALGAPVYETGRAASRCTTGKSHFYPGLCST 251
            ..:     |:.::.        .:|||| ....:|...|:.|:..|.|...    |.|.|::
Human   186 TCS-----SISVWGNTWHRAAYLVCNYAIKGNWIGESPYKMGKPCSSCPPS----YQGSCNS 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 32/156 (21%)
R3HDMLNP_848586.1 SCP 65..207 CDD:320774 31/155 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151177
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5261
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.