DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and Crisp3

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_033769.1 Gene:Crisp3 / 11572 MGIID:102552 Length:241 Species:Mus musculus


Alignment Length:199 Identity:41/199 - (20%)
Similarity:66/199 - (33%) Gaps:45/199 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 DFLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANSGQ 129
            :.:..||:.|..::    |.   .:.:..|.|:.:.|..:......|...|............|:
Mouse    41 EIVSKHNQLRRKVS----PS---GSDLLNMEWNYDAQVNAQQRADKCTFSHSPIELRTTNLKCGE 98

  Fly   130 NL-----CAVWRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTP--IFEDYGHFAELSV 187
            ||     ...|         :|:::.    |:||    ....|  |.|.|  .....||..::..
Mouse    99 NLFMSSYLVPW---------SSVIQG----WYNE----SKGLI--FGVGPKQNVSVVGHHTQVVW 144

  Fly   188 DKNFAVGCSIMRFTRPDYPSVYIYNFIC------NYASLYALGAPVYETGRAASRCTTGKSHFYP 246
            ..|..|.|.:...  |:.|..|.|  :|      ||:..|.....:..|.||.  |.:.......
Mouse   145 KSNLQVACGVAEC--PENPLRYFY--VCRYCPVLNYSGHYPSRPYLAYTARAP--CASCPDRCED 203

  Fly   247 GLCS 250
            |||:
Mouse   204 GLCT 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 32/165 (19%)
Crisp3NP_033769.1 SCP 37..172 CDD:294090 31/160 (19%)
Crisp 194..241 CDD:285731 4/14 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841454
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.