DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and GLIPR1

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_006842.2 Gene:GLIPR1 / 11010 HGNCID:17001 Length:266 Species:Homo sapiens


Alignment Length:230 Identity:53/230 - (23%)
Similarity:85/230 - (36%) Gaps:52/230 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PDAVQVDVSRHKADFLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHD 116
            ||....|..:   |.:..|||.|:.:.    |   .|:.|..|.||..|..::......|:..|:
Human    26 PDIENEDFIK---DCVRIHNKFRSEVK----P---TASDMLYMTWDPALAQIAKAWASNCQFSHN 80

  Fly   117 ----DCHNTY-RYANSGQNLCAVWRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIF 176
                ..|..: .:.:.|:|   :|....|..:|:|.:..    |::|....|      ||.....
Human    81 TRLKPPHKLHPNFTSLGEN---IWTGSVPIFSVSSAITN----WYDEIQDYD------FKTRICK 132

  Fly   177 EDYGHFAELSVDKNFAVGCSIMRFTRPDYPSVYIY-------NFICNYASLYALGAPVYETGRAA 234
            :..||:.::....::.|||:: :|.    |.|..:       :|||||..........|:.|...
Human   133 KVCGHYTQVVWADSYKVGCAV-QFC----PKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATC 192

  Fly   235 SRCTTGKSHFYPGLCSTRE----------VYDPNW 259
            |.| .........||..|:          || |.|
Human   193 SAC-PNNDKCLDNLCVNRQRDQVKRYYSVVY-PGW 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 38/166 (23%)
GLIPR1NP_006842.2 SCP_GLIPR-1_like 32..178 CDD:240185 40/173 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151240
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.