Sequence 1: | NP_611582.1 | Gene: | CG17974 / 37441 | FlyBaseID: | FBgn0034624 | Length: | 259 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005162473.1 | Gene: | LOC101883528 / 101883528 | -ID: | - | Length: | 261 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 43/199 - (21%) |
---|---|---|---|
Similarity: | 74/199 - (37%) | Gaps: | 45/199 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 70 HNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANSGQNLCAV 134
Fly 135 WRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIFED--YGHFAELSVDKNFAVGCSI 197
Fly 198 --------MRFTRPDYPSVYIYNFICNYASLYAL-GAPVYETGRAASRCTTGKSHFYPGLCSTRE 253
Fly 254 VYDP 257 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17974 | NP_611582.1 | SCP_euk | 63..218 | CDD:240180 | 34/157 (22%) |
LOC101883528 | XP_005162473.1 | SCP_HrTT-1 | 28..162 | CDD:240186 | 34/157 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |