DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and crispld2

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_003199065.1 Gene:crispld2 / 100535149 ZFINID:ZDB-GENE-130131-1 Length:508 Species:Danio rerio


Alignment Length:236 Identity:59/236 - (25%)
Similarity:96/236 - (40%) Gaps:56/236 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FHRRCQPDAVQVD--VSRHKA-------DFLHAHNKRRNFLALGKVPGYYP-AARMATMVWDDEL 100
            :....:|::.:.|  |...:|       :.|..|||.|     |:|   || |:.|..|:|||||
Zfish    35 YQEELEPNSTKPDAPVRTRRAIEWSDREEILKLHNKLR-----GEV---YPTASNMEYMIWDDEL 91

  Fly   101 QYLSMLNTRTCKLDH--DDCHNTYRYANSGQNLCAVW-RPRSPHVNVTSLVEECLGLWFNEFDLI 162
            :..:......|:.:|  .|.     ..:.||||...| |.|||..:|.:        |::|  :.
Zfish    92 ERSATSWAEQCQWEHGPQDL-----LMSIGQNLAVHWGRYRSPAYHVQA--------WYDE--VK 141

  Fly   163 DSSFIDSFKVTPIFED------YGHFAELSVDKNFAVGCSIMRFTRPDY------PSVYIYNFIC 215
            |.::....:..|...:      ..|:.:|.......|||::....|.:.      .:||:   :|
Zfish   142 DYTYPYPHECNPWCPERCSGPMCTHYTQLVWATTNRVGCAVHVCPRMNVWGEIWENAVYL---VC 203

  Fly   216 NYASL-YALGAPVYETGRAASRCTTGKSHFYPGLCSTREVY 255
            ||:.. ..:|...|:.||..|:|...    |.|:|.....|
Zfish   204 NYSPKGNWIGEAPYQHGRPCSQCPPS----YGGVCRDNLCY 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 45/177 (25%)
crispld2XP_003199065.1 SCP_euk 61..206 CDD:240180 44/170 (26%)
LCCL 299..382 CDD:128866
LCCL 402..495 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585814
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.