DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and crispld1

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_002937123.2 Gene:crispld1 / 100490431 XenbaseID:XB-GENE-989389 Length:514 Species:Xenopus tropicalis


Alignment Length:244 Identity:60/244 - (24%)
Similarity:90/244 - (36%) Gaps:69/244 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PDAVQVD--------------VSRHKAD----------FLHAHNKRRNFLALGKVPGYYPAARMA 92
            |:|.|::              .::|:..          .|..|||.|     |:|  |.||:.|.
 Frog    27 PNATQLEGLLEKYMDEDGEWWTAKHRGKRAITESDMKLILDLHNKLR-----GEV--YPPASNME 84

  Fly    93 TMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANSGQNLCAVW---RPRSPHVNVTSLVEECLGL 154
            .|:||.||:..:.....||..:|....   .....||||.|.|   ||.:.||..          
 Frog    85 FMIWDVELERSAEAWAETCLWEHGPAD---LLPVIGQNLGAHWGRYRPPTYHVQA---------- 136

  Fly   155 WFNEFDLIDSSFIDSFKVTPI--FEDYG----HFAELSVDKNFAVGCSI-----MRFTRPDYP-S 207
            |::|  :.|.:|....:..|.  |...|    |:.:|....:..:||:|     |......:| :
 Frog   137 WYDE--VRDYTFPYPQECDPYCPFRCSGPVCTHYTQLVWATSSRIGCAINLCHNMNVWGQIWPKA 199

  Fly   208 VYIYNFICNYASL-YALGAPVYETGRAASRCTTGKSHFYPGLCSTREVY 255
            :|:   :|||:.. ...|...|:.|...|.|...    |.|.|.....|
 Frog   200 IYL---VCNYSPKGNWWGHAPYKHGHPCSACPPS----YGGGCKDNLCY 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 46/179 (26%)
crispld1XP_002937123.2 CAP_CRISPLD1 62..207 CDD:349407 46/169 (27%)
LCCL 304..388 CDD:128866
LCCL 407..506 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.