DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and LOC100490275

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_031754789.1 Gene:LOC100490275 / 100490275 -ID:- Length:291 Species:Xenopus tropicalis


Alignment Length:187 Identity:49/187 - (26%)
Similarity:70/187 - (37%) Gaps:40/187 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RHKADFLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKL---DHDDCHNTY 122
            |...|.::|||..||  ..||     .||.|..|.||..|..|:...|..||.   .|.:..:.|
 Frog    28 RFVTDLVNAHNDIRN--EFGK-----QAANMLHMSWDVGLAKLAQAWTINCKKVPNPHLNKESIY 85

  Fly   123 -RYANSGQNLCAVWRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIFEDYGHFAELS 186
             |:...|:||.     ..|.:::..:|.. .||..|.:||.::|....       :|..||.::.
 Frog    86 PRFKQIGENLY-----MGPSIDIFKIVTN-WGLEGNFYDLKNNSCQPG-------KDCSHFTQIV 137

  Fly   187 VDKNFAVGCSIMRFTRPDYPSVY-----IYNFICNYASL-YALGAPVYETGRAASRC 237
            ....:.|||.          :.|     .|...|.|... ..||...:..|...|:|
 Frog   138 WANTYKVGCG----------AAYCAHKVAYVVSCTYGPRGNLLGQVPFILGVKCSKC 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 42/163 (26%)
LOC100490275XP_031754789.1 CAP 28..167 CDD:412178 44/168 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5157
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.