DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and pi15

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_002937120.1 Gene:pi15 / 100489915 XenbaseID:XB-GENE-989406 Length:258 Species:Xenopus tropicalis


Alignment Length:264 Identity:64/264 - (24%)
Similarity:99/264 - (37%) Gaps:79/264 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AKDYSWCDPDLCGNGVRHIACRTTGNFHRRCQPDAVQVDVSRHK--------ADFLHAHNKRRNF 76
            |.:|:...|||                  ..:.||.:|..:|.|        ...:..||:.|  
 Frog    34 ASNYTIIKPDL------------------SARLDAAKVPKARRKRYISQNDMIAIVEYHNQVR-- 78

  Fly    77 LALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANSGQNLCAVWRPRSPH 141
               |||  :.|||.|..||||:.|..|:.....||..||..   :|.....|||| :|...|  :
 Frog    79 ---GKV--FPPAANMEYMVWDENLAKLAEAWAATCIWDHGP---SYLLKFLGQNL-SVRTGR--Y 132

  Fly   142 VNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTP--IFEDYG----HFAELSVDKNFAVGCSIMRF 200
            .::..||:.    |::|  :.|.:|....:..|  ....||    |:.::.......:||:|...
 Frog   133 KSILQLVKP----WYDE--VKDYAFPYPQECNPRCPLRCYGPMCTHYTQMVWATTNRIGCAIHTC 191

  Fly   201 TRPDY------PSVYIYNFICNYA--------SLYALGAPVYETGRAASRCTTGKSHFYPGLCST 251
            ...:.      .:||:   :|||:        :.|.:|.|       .|.|...    |.|.||.
 Frog   192 HNMNVWGAVWRRAVYL---VCNYSPKGNWIGEAPYTIGVP-------CSACPPS----YGGSCSD 242

  Fly   252 REVY 255
            .:.:
 Frog   243 NQCF 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 45/174 (26%)
pi15XP_002937120.1 CAP_PI15 67..212 CDD:349408 44/166 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.