DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and XB5812873

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_031758624.1 Gene:XB5812873 / 100127722 XenbaseID:XB-GENE-5812874 Length:272 Species:Xenopus tropicalis


Alignment Length:211 Identity:48/211 - (22%)
Similarity:78/211 - (36%) Gaps:59/211 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DAVQVDVSRHKADFLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLN--TRTCKLDH 115
            |.:..|:..::...:..||..|:::.    |   |||.|..|.||:  .||:...  ..||...|
 Frog    57 DEMSTDLESNRNFIVDKHNYYRSWVN----P---PAADMLKMHWDN--YYLAKAKEWALTCSFKH 112

  Fly   116 DD-CHNTYRYANSGQNLCAVWRPRSPHVNVTSLVEECLGLWFNEFDLIDSSF-IDSFK---VTPI 175
            .: ....|....:|:|:...:...|        .|..:..||||.  ::..: :.:.|   ||  
 Frog   113 SNLSFRQYGGEFAGENIMNSYFRHS--------WEYVINYWFNEH--VNWEYAVGTTKEGAVT-- 165

  Fly   176 FEDYGHFAELSVDKNFAVGCSIMRFTRPDYPSVYIYNFICNYASLYALGAPVYETGRAASRCTTG 240
                |||.::......|:.|.:.:.    |.:.|.|.::|.|          |.||....:..| 
 Frog   166 ----GHFTQIIWAPTHALACYVAKC----YGTPYNYFYVCIY----------YPTGNREDKVKT- 211

  Fly   241 KSHFYP-------GLC 249
                 |       |||
 Frog   212 -----PYQNGTTCGLC 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 37/161 (23%)
XB5812873XP_031758624.1 CAP 65..201 CDD:412178 38/174 (22%)
Crisp 219..269 CDD:400739 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.