DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and R3hdml

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001092801.1 Gene:R3hdml / 100043899 MGIID:3650937 Length:253 Species:Mus musculus


Alignment Length:248 Identity:57/248 - (22%)
Similarity:84/248 - (33%) Gaps:79/248 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LCGNGV------RHIACRTTGNFHRRCQPDAVQVDVSRHKADFLHAHNKRRNFLALGKVPGYYPA 88
            |.|.||      |||:.|                |:|.    .|..||..|..:       :.||
Mouse    44 LSGLGVPRHRRKRHISAR----------------DMSA----LLDYHNHIRASV-------HPPA 81

  Fly    89 ARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANSGQNLCAVWRPRSPHVNVTSLVEECLG 153
            |.|..||||::|...:......|...|.. ....:|.  ||||       |.|......|.:.:.
Mouse    82 ANMEYMVWDEQLARSAEAWATQCIWTHGP-SQLMKYV--GQNL-------SIHSGRFRSVVDLVR 136

  Fly   154 LWFNEFDLIDSSFIDSFKVTPIFED-------------YGHFAELSVDKNFAVGCSIMRFTRPD- 204
            .|..|  ....||       |..:|             ..|:.::....:..:||:|...:..: 
Mouse   137 SWSEE--KRHYSF-------PAPKDCTPHCPWLCSGPVCSHYTQMVWASSSRLGCAINTCSSINV 192

  Fly   205 -----YPSVYIYNFICNYA-SLYALGAPVYETGRAASRCTTGKSHFYPGLCST 251
                 ..:||:   :|||| ....:|...|:.|:..|.|...    |.|.|::
Mouse   193 WGNTWQQAVYL---VCNYAIKGNWIGEAPYKAGKPCSACPPS----YQGNCNS 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 37/173 (21%)
R3hdmlNP_001092801.1 CAP_R3HDML 63..208 CDD:349409 38/177 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841254
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.