DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and PRY3

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_012457.1 Gene:PRY3 / 853367 SGDID:S000003614 Length:881 Species:Saccharomyces cerevisiae


Alignment Length:209 Identity:43/209 - (20%)
Similarity:70/209 - (33%) Gaps:63/209 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 IVNEHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDC-----HNSYRFR 126
            ::|||||.|.....           .|.:.|.:.|...|     ..|.:..||     |:...: 
Yeast    29 VLNEHNKFRALHVD-----------TAPLTWSDTLATYA-----QNYADQYDCSGVLTHSDGPY- 76

  Fly   127 NLGQNLCGVDRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKD--LEKYGHFVETVLD 189
              |:||.         |..|:  ..::..|:||        |:.:..:..  .|..|||.:.|..
Yeast    77 --GENLA---------LGYTD--TGAVDAWYGE--------ISKYNYSNPGFSESTGHFTQVVWK 120

  Fly   190 RNTHVGCAMMRFTNPQYPFL------YI---YNTACNYASVYAIGV-PVYNAGKPASECRTGSNP 244
            ....:||.        |.:.      ||   ||...||...:|..| |:.:....:|...:.::.
Yeast   121 STAEIGCG--------YKYCGTTWNNYIVCSYNPPGNYLGEFAEEVEPLISTVSSSSSSSSSTST 177

  Fly   245 EYPALCSIKEQYNP 258
            ....:.:|.....|
Yeast   178 TSDTVSTISSSIMP 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 36/167 (22%)
PRY3NP_012457.1 CAP_PRY1-like 24..152 CDD:349403 37/168 (22%)
ser_rich_anae_1 <598..>855 CDD:411418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344575
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.