DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and PRY1

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_012456.1 Gene:PRY1 / 853366 SGDID:S000003615 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:172 Identity:42/172 - (24%)
Similarity:62/172 - (36%) Gaps:38/172 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 DLKPYRKLIVNEHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSY 123
            ||..:...::.||||:|      :|....||     :.|.:.|...|     ..|.::.||..:.
Yeast   158 DLSDFASSVLAEHNKKR------ALHKDTPA-----LSWSDTLASYA-----QDYADNYDCSGTL 206

  Fly   124 RFRN--LGQNLC-GVDRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYGHFVE 185
            ....  .|:||. |.|.            ..::..|:.|    .|:|  ||.........|||.:
Yeast   207 THSGGPYGENLALGYDG------------PAAVDAWYNE----ISNY--DFSNPGFSSNTGHFTQ 253

  Fly   186 TVLDRNTHVGCAMMRFTNPQYPFLYI-YNTACNYASVYAIGV 226
            .|....|.|||.:.........::.. |:.|.||...||..|
Yeast   254 VVWKSTTQVGCGIKTCGGAWGDYVICSYDPAGNYEGEYADNV 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 36/158 (23%)
PRY1NP_012456.1 CAP_PRY1-like 166..289 CDD:349403 37/156 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344533
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.