DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and CRISPLD2

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_113664.1 Gene:CRISPLD2 / 83716 HGNCID:25248 Length:497 Species:Homo sapiens


Alignment Length:266 Identity:64/266 - (24%)
Similarity:94/266 - (35%) Gaps:73/266 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PDNTVHIACNNDGKFHESCSPDATMVD--LKPY---------RKLIVNE--------HNKRRNYI 78
            |...:.:.|.:.|..    .|:.|:::  |..|         |:.|..|        |||.|..:
Human    10 PLGLLFLVCGSQGYL----LPNVTLLEELLSKYQHNESHSRVRRAIPREDKEEILMLHNKLRGQV 70

  Fly    79 ASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNLGQNLCGV--DRRRNW 141
            ..       .|:.|..|.||:|||..|......|..||..   :....::|||| |.  .|.|:.
Human    71 QP-------QASNMEYMTWDDELEKSAAAWASQCIWEHGP---TSLLVSIGQNL-GAHWGRYRSP 124

  Fly   142 DLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYG----HFVETVLDRNTHVGCAMMR-- 200
            ..:|.:        |:.|.|.....|.::..........|    |:.:.|......:|||:..  
Human   125 GFHVQS--------WYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQIVWATTNKIGCAVNTCR 181

  Fly   201 --------FTNPQYPFLYIYNTACNYASVYAIGVPVYNAGKPASECRTGSNPEYPA-----LCSI 252
                    :.|..| |:..|:...|:     ||...|..|:|.|||    .|.|..     ||..
Human   182 KMTVWGEVWENAVY-FVCNYSPKGNW-----IGEAPYKNGRPCSEC----PPSYGGSCRNNLCYR 236

  Fly   253 KEQYNP 258
            :|.|.|
Human   237 EETYTP 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 42/178 (24%)
CRISPLD2NP_113664.1 SCP_euk 56..201 CDD:240180 37/164 (23%)
LCCL 286..370 CDD:128866
LCCL 387..479 CDD:128866
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151215
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.