Sequence 1: | NP_611581.1 | Gene: | CG9822 / 37440 | FlyBaseID: | FBgn0034623 | Length: | 263 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_113649.1 | Gene: | CRISPLD1 / 83690 | HGNCID: | 18206 | Length: | 500 | Species: | Homo sapiens |
Alignment Length: | 215 | Identity: | 55/215 - (25%) |
---|---|---|---|
Similarity: | 82/215 - (38%) | Gaps: | 63/215 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 67 IVNEHNKRRNYIASGSLPGYYP-ATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNLGQ 130
Fly 131 NLCGV--DRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSY--------ITDFKLTKDLEKYGHFVE 185
Fly 186 TVLDRNTHVGCAMMRFTN--------PQYPFLYIYNTACNYA-SVYAIGVPVYNAGKPASEC--- 238
Fly 239 -----------RTGSNPEYP 247 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9822 | NP_611581.1 | SCP_euk | 64..219 | CDD:240180 | 44/170 (26%) |
CRISPLD1 | NP_113649.1 | SCP_euk | 63..207 | CDD:240180 | 44/170 (26%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 254..281 | ||||
LCCL | 291..375 | CDD:128866 | |||
LCCL | 392..483 | CDD:128866 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165151152 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2340 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10334 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.850 |