DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and AT4G33720

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_195098.1 Gene:AT4G33720 / 829514 AraportID:AT4G33720 Length:163 Species:Arabidopsis thaliana


Alignment Length:153 Identity:35/153 - (22%)
Similarity:57/153 - (37%) Gaps:43/153 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 HNKRRNYIASGSLPGYYPATRMATMVWDEEL----EYLATLNLKTCYLEHDDCHNSYRFRNLGQN 131
            ||:.|..:..|.|.            |||::    ...|......|.::|..  .||     |:|
plant    37 HNRARAEVGVGPLR------------WDEKVAAYARNYANQRKGDCAMKHSS--GSY-----GEN 82

  Fly   132 LCGVDRRRNWDL-NVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRNTHVG 195
            :.       |.. ::|.:.  ::.:|..|.  .|..|  |.......::.||:.:.|...:..:|
plant    83 IA-------WSSGSMTGVA--AVDMWVDEQ--FDYDY--DSNTCAWDKQCGHYTQVVWRNSERLG 134

  Fly   196 CAMMRFTNPQYPFLYIYNTACNY 218
            ||.:|..|.| .|:     .|||
plant   135 CAKVRCNNGQ-TFI-----TCNY 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 35/153 (23%)
AT4G33720NP_195098.1 CAP_PR-1 30..163 CDD:349400 35/153 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.