DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and AT3G19690

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_188603.1 Gene:AT3G19690 / 821506 AraportID:AT3G19690 Length:161 Species:Arabidopsis thaliana


Alignment Length:178 Identity:37/178 - (20%)
Similarity:65/178 - (36%) Gaps:51/178 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 FHESCSPDATMVDLKPYRKLIVNEHNKRRNYIASGSLPGYYPATRMATMVWDEEL-EYLATL--- 107
            |:.|.:.|        .::..:..||:.||.:      |..|      :|||:|: .|.|:.   
plant    17 FYGSLAED--------LQQQFLEAHNEARNEV------GLDP------LVWDDEVAAYAASYANQ 61

  Fly   108 NLKTCYLEHDDCHNSYRFRNLGQNLCGVDRRRNWDLNVTNLVEQSMGLWFGEHKL--IDSSYITD 170
            .:..|.|.|.:       ...|:|:.    ..:.:::..:..|    :|..|.:.  .||:...|
plant    62 RINDCALVHSN-------GPFGENIA----MSSGEMSAEDAAE----MWINEKQYYDYDSNTCND 111

  Fly   171 FKLTKDLEKYGHFVETVLDRNTHVGCAMMRFTNPQYPFLYIYNTACNY 218
            ......|    |:.:.|......:|||.: ..|....|:     .|||
plant   112 PNGGTCL----HYTQVVWKNTVRLGCAKV-VCNSGGTFI-----TCNY 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 34/161 (21%)
AT3G19690NP_188603.1 CAP_PR-1 26..161 CDD:349400 34/161 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.