DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and AT3G09590

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_187570.1 Gene:AT3G09590 / 820116 AraportID:AT3G09590 Length:186 Species:Arabidopsis thaliana


Alignment Length:213 Identity:48/213 - (22%)
Similarity:73/213 - (34%) Gaps:54/213 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CLLIILGMASSQP--LSWCDPDLCPDNTVHIACNNDGKFHESCSPDATMVDLKPYRKL---IVNE 70
            |||::..:.|..|  |....||..  ||.                 |.:|:.....||   .:..
plant    11 CLLLLFLLFSGHPSVLGTSIPDAV--NTA-----------------ARLVNRARRAKLSREFLQA 56

  Fly    71 HNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNLGQNLCGV 135
            ||..|  ::||          :.|:.||.:|...|.   |.......||...:.....|:|:...
plant    57 HNDAR--VSSG----------VPTLGWDRDLARFAD---KWAKQRKSDCSMIHSGGPYGENIFWH 106

  Fly   136 DRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRNTHVGCAMMR 200
            .|::.|.      .|:.:..||.|.    .:|..........:..||:.:.|....|.||||.::
plant   107 RRKKTWS------PEKVVTRWFEER----FNYDVKTNTCAPGKMCGHYTQMVWRETTAVGCARVK 161

  Fly   201 FTNPQYPFLYIYNTACNY 218
            ..|.:.     |...|.|
plant   162 CHNGRG-----YLVVCEY 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 36/158 (23%)
AT3G09590NP_187570.1 CAP_PR-1 50..186 CDD:349400 34/155 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.