DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and PRB1

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_179064.1 Gene:PRB1 / 815945 AraportID:AT2G14580 Length:161 Species:Arabidopsis thaliana


Alignment Length:172 Identity:43/172 - (25%)
Similarity:61/172 - (35%) Gaps:39/172 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 ATMVDLKPY--RKLIVNEHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLA---TLNLK-TCY 113
            |.:|.||..  ::..||.||:.|:.|..|            .|.|||.|...|   ...|| .|.
plant    19 ALVVPLKAQDSQQDYVNAHNQARSQIGVG------------PMQWDEGLAAYARNYANQLKGDCR 71

  Fly   114 LEHDDCHNSYRFRNLGQNLCGVDRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLE 178
            |.|............|.:|.||               .::.||..|    .::|..|......: 
plant    72 LVHSRGPYGENLAKSGGDLSGV---------------AAVNLWVNE----KANYNYDTNTCNGV- 116

  Fly   179 KYGHFVETVLDRNTHVGCAMMRFTNPQYPFLYIYNTACNYAS 220
             .||:.:.|...:..:|||.:|..|........|:...|||:
plant   117 -CGHYTQVVWRNSVRLGCAKVRCNNGGTIISCNYDPPGNYAN 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 37/158 (23%)
PRB1NP_179064.1 CAP_PR-1 30..161 CDD:349400 39/161 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.