DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and Pi16

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_076223.3 Gene:Pi16 / 74116 MGIID:1921366 Length:498 Species:Mus musculus


Alignment Length:252 Identity:61/252 - (24%)
Similarity:85/252 - (33%) Gaps:89/252 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 HESCSP---------------------------DATMVDLKPYRKLIVNEHNKRRNYIASGSLPG 85
            |.||||                           ..|||||          ||:.|..::.     
Mouse     2 HGSCSPWVMLPPPLLLLLLLIATGPTTALTEDEKQTMVDL----------HNQYRAQVSP----- 51

  Fly    86 YYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNLGQNLC-----GVDRRRNWDLNV 145
              ||:.|..|.||:||...|....:.|...    ||..|.|. |:||.     |:|         
Mouse    52 --PASDMLQMRWDDELAAFAKAYAQKCVWG----HNKERGRR-GENLFAITDEGMD--------- 100

  Fly   146 TNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRNTHVGCAM--------MRFT 202
               |..::|.|..||:..:.|..|    ....:..||:.:.|..:...:||..        :...
Mouse   101 ---VPLAVGNWHEEHEYYNFSTAT----CDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEA 158

  Fly   203 NPQYPFLYIYNTACNYASVYAI-GVPVYNAGKPASECRTGSNPEYPALCSIKEQYNP 258
            |       |:...|||.....: |...|..|.|.|:|..|.:.| .:||  :...||
Mouse   159 N-------IHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCE-NSLC--EPMRNP 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 38/167 (23%)
Pi16NP_076223.3 SCP_HrTT-1 35..168 CDD:240186 43/177 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..277 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..407
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.