DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and Glipr1

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_006514280.1 Gene:Glipr1 / 73690 MGIID:1920940 Length:270 Species:Mus musculus


Alignment Length:234 Identity:60/234 - (25%)
Similarity:89/234 - (38%) Gaps:61/234 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLIILGMASSQPLSWCDPDLCPDNTVHIACNNDGKFHESCSPDATMVDLKPYRKLIVNEHNKRRN 76
            |.:|:.||||.                    :...|..|..||.|..|   :.|..|..||:.|:
Mouse     5 LAVIVWMASSV--------------------SSSSFTASTLPDITNED---FIKECVQVHNQLRS 46

  Fly    77 YIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHD-DCHNSY--RFRNLGQNLCGVDRR 138
            .::.       ||..|..|.||.:|..:|....|:|..:|: ..|:..  .|..||:|:      
Mouse    47 KVSP-------PARNMLYMSWDPKLAQIAKAWTKSCEFKHNPQLHSRIHPNFTALGENI------ 98

  Fly   139 RNW--DLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRNTHVGCAMMRF 201
              |  .|::.: |..::..|:.|.|    .|  ||...|.....||:.:.|...:..:|||:...
Mouse    99 --WLGSLSIFS-VSSAISAWYEEIK----HY--DFSTRKCRHVCGHYTQVVWADSYKLGCAVQLC 154

  Fly   202 TNPQYPFLYIYNTACNYASVYAIGVPV--YNAGKPASEC 238
            .|.. .|:..|..|.||        |.  |..|...|:|
Mouse   155 PNGA-NFICDYGPAGNY--------PTWPYKQGATCSDC 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 42/159 (26%)
Glipr1XP_006514280.1 CAP_GLIPR1-like 32..168 CDD:349404 41/161 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841313
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.