DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and Glipr1l1

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_081294.1 Gene:Glipr1l1 / 69286 MGIID:1916536 Length:236 Species:Mus musculus


Alignment Length:218 Identity:53/218 - (24%)
Similarity:85/218 - (38%) Gaps:46/218 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 TMVDLKPYRKLIVNEHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHD--- 117
            |:.|.| :....:|.||:.|..:..       ||..|..:.||::|..||....:.|.|.|:   
Mouse    35 TITDPK-FIDAFLNIHNELRRKVQP-------PAADMNQLFWDQQLAKLAKAWTRECKLAHNPCI 91

  Fly   118 ----DCHNSYRFRNLGQNL-CGVDRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDL 177
                :|...|.|  :|:|: .|....:..|:.:.         |:.|.|..      :|......
Mouse    92 KQRYECLEDYDF--IGENIYLGRIETQPEDVVIN---------WYNESKYF------NFDFNTCS 139

  Fly   178 EKYGHFVETVLDRNTHVGCAMMRFTNPQ--YPFLYIYNTACNYASV-YAIGVPVYNAGKPASEC- 238
            |..||:.:.|..:...:|||:....|.:  ...|::    |||:.. ..||...|..|...|.| 
Mouse   140 EMCGHYTQVVWAKTVKIGCAVSNCPNLKGFSAGLFV----CNYSPAGNFIGFRPYTRGDSCSMCG 200

  Fly   239 -RTGSNPEYPALCSIKEQYNPNH 260
             :|..|    :||....:..|:|
Mouse   201 QKTCEN----SLCRPMNRKTPHH 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 37/164 (23%)
Glipr1l1NP_081294.1 SCP_GLIPR-1_like 40..181 CDD:240185 39/169 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841382
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.