DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and crispld2

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001027499.1 Gene:crispld2 / 613091 XenbaseID:XB-GENE-985953 Length:500 Species:Xenopus tropicalis


Alignment Length:250 Identity:61/250 - (24%)
Similarity:90/250 - (36%) Gaps:86/250 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 ESC----SPDATMVD-------------------LKPYRKLIVNEHNKRRNYIASGSLPGYYP-A 89
            |.|    :|::|.::                   |:..::.|:..|||.|..:        :| |
 Frog    19 EQCYCIFAPNSTFLENLLNKYKDTTPHSRTRRAILRTDKEEIIQLHNKLRGQV--------HPSA 75

  Fly    90 TRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNLGQNLC---GVDRRRNWDLNVTNLVEQ 151
            :.|..|.||:|||..|....:.|..||..   :....::||||.   |..|:..:.:       |
 Frog    76 SNMEYMTWDDELEKSAEAWAEECIWEHGP---TALLMSIGQNLAVHWGRYRQPAYHV-------Q 130

  Fly   152 SMGLWFGEHKLIDSSYITDFKLTKDLEKY----------GHFVETVLDRNTHVGCAM-----MR- 200
            |   |:.|.|  |.:|    ....:...|          .|:.:.|....|.||||:     |. 
 Frog   131 S---WYDEVK--DYTY----PYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNV 186

  Fly   201 ----FTNPQYPFLYIYNTACNYA-SVYAIGVPVYNAGKPASECRTGSNPEYPALC 250
                :.|..|       ..|||: ....||...|..|:|.|||    .|.|...|
 Frog   187 WGDIWENAVY-------LVCNYSPKGNWIGEAPYKNGRPCSEC----PPSYGGNC 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 44/178 (25%)
crispld2NP_001027499.1 SCP_euk 57..202 CDD:240180 44/178 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..281
LCCL 289..373 CDD:128866
LCCL 392..490 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.