DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and pi15a

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001153449.1 Gene:pi15a / 561978 ZFINID:ZDB-GENE-040724-135 Length:260 Species:Danio rerio


Alignment Length:199 Identity:59/199 - (29%)
Similarity:78/199 - (39%) Gaps:41/199 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 IVNEHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNLGQN 131
            |::.|||.|..:       :.||:.|..||||:.|...|.....||..||.. .|..||  ||||
Zfish    72 ILDYHNKVRGKV-------FPPASNMEYMVWDDTLAKTAEQWASTCIWEHGP-RNLLRF--LGQN 126

  Fly   132 L-CGVDRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYG----HFVETVLDRN 191
            | ....|.|    ::..||:.    |..|.|.....|..|......|:.||    |:.:.|...:
Zfish   127 LSVRTGRYR----SILQLVKP----WHDEVKDYSFPYPRDCNPRCPLKCYGPMCTHYTQMVWATS 183

  Fly   192 THVGCAMMRFTNPQYPFLYIYNT--------ACNYA-SVYAIGVPVYNAGKPASECRTGSNPEYP 247
            ..||||:....|     :.::.:        .|||: ....||...|..|.|.|.|    .|.|.
Zfish   184 NKVGCAINTCHN-----MNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSMC----PPSYG 239

  Fly   248 ALCS 251
            ..||
Zfish   240 GSCS 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 47/164 (29%)
pi15aNP_001153449.1 SCP_euk 71..214 CDD:240180 47/164 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585789
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.