DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and im:7150988

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_002667823.1 Gene:im:7150988 / 504039 ZFINID:ZDB-GENE-050309-169 Length:150 Species:Danio rerio


Alignment Length:142 Identity:27/142 - (19%)
Similarity:51/142 - (35%) Gaps:37/142 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 YRKLIVNEHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNS----Y 123
            :::..:..||:.|:...:..|. |......|...|.|.:     |:.|:  |.|.:..|.    |
Zfish     6 FKQEFLQTHNQYRHQHQAPPLV-YREDLCRAAQKWAEHM-----LSKKS--LGHSETENGENVYY 62

  Fly   124 RFRNLGQNLCGVDRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKD--LEKYGHFVET 186
            .|.::.:...|               ::::..|:.|        |.|:...|.  ..|.|||.:.
Zfish    63 SFSSVKKTPTG---------------KEAVDSWYSE--------IKDYNFAKSGHQPKTGHFTQV 104

  Fly   187 VLDRNTHVGCAM 198
            |...:..:|..:
Zfish   105 VWKSSKELGVGL 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 27/141 (19%)
im:7150988XP_002667823.1 SCP_GAPR-1_like 5..135 CDD:240182 27/142 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.