DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and scpr-A

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster


Alignment Length:260 Identity:89/260 - (34%)
Similarity:130/260 - (50%) Gaps:17/260 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FQTVGCLLIILGMASSQPLSWCDPDLCPDNTVHIACNNDGKFHESCSPDATMVDLKPYRKLIVNE 70
            |..|..|:::..:|.|..:.:|....|.|.  |:||||.|.|.|:|..|...|.::|:.|||:|.
  Fly     3 FTKVLQLILLAVVAISSAVDYCALPTCLDK--HVACNNKGNFSENCPKDVREVKIEPHHKLILNL 65

  Fly    71 HNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNLGQN---- 131
            .|:.||.:|.|.:.|...|.|||.|.|.|||.:||.||:|||....|.|.::.||...|||    
  Fly    66 FNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNALF 130

  Fly   132 -LCGVDRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRNTHVG 195
             ..|.:.    :.....::::.:..||.|........:..|......:....|...|.::|||||
  Fly   131 QYSGAET----EYTDAEIIKEEIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVG 191

  Fly   196 CAMMRFTNPQYPFLYIYNTACNYASVYAIGVPVYNAGKPASE-C--RTGSNPEYPALCSIKEQYN 257
            ||.:||:...|....:   .||:|:...:|.|||..|:.|:. |  |.|:..:||.||..||.|:
  Fly   192 CAAVRFSRDFYNHFVL---TCNFATSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLCYAKEIYD 253

  Fly   258  257
              Fly   254  253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 52/159 (33%)
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 52/158 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440542
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.