DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and CG11977

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster


Alignment Length:217 Identity:54/217 - (24%)
Similarity:93/217 - (42%) Gaps:36/217 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QPLSWCDPDLCPDNTVHIAC------NNDGKFHESCSPDATMVDLKPYRKLIVNEHNKRRNYI-- 78
            :|..:|:.|:||.|..||.|      ...|:.||.       |.:..||..||...|..|..:  
  Fly    40 KPPDYCNADICPANKKHITCGFKFWSTKCGRNHEG-------VRMSDYRYDIVRNVNNFRRKLEW 97

  Fly    79 ASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEH--DDCHNSYRFRNLGQNLCGVD-RRRN 140
            ..|:||   .|.:...:.||:||..:|......| |:|  ..|.|::.::::|::...|. :..:
  Fly    98 GLGNLP---RAVKFKNIKWDDELSVMAMRVSNQC-LQHTFSPCVNTFLYKDVGESSDFVKVQNTS 158

  Fly   141 WDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRNTHVGCAMMR----- 200
            ...||.:.    :.:||..||::..||:.:|......::...|...:.::|..:||.|::     
  Fly   159 KGFNVISF----LNMWFEYHKMMKPSYVNNFPNIAPQDRLIIFANLIYEKNKKMGCGMVKSGQGR 219

  Fly   201 -----FTNPQYPFLYIYNTACN 217
                 |.....|...:|.|..|
  Fly   220 FLTCLFDKKIKPNQKLYTTRLN 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 40/169 (24%)
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 35/152 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.