DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and crisp1.7

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_989314.1 Gene:crisp1.7 / 394939 XenbaseID:XB-GENE-5779195 Length:244 Species:Xenopus tropicalis


Alignment Length:216 Identity:49/216 - (22%)
Similarity:75/216 - (34%) Gaps:60/216 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 RKLIVNEHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNL 128
            |:.||:.||..|.    .:.|   .|:.|..|.|..|.|..|.....||    :..|:....|.:
 Frog    34 RQKIVDIHNAYRR----SANP---TASNMLKMSWSIEAENNAKNWATTC----NQYHSQPAARQI 87

  Fly   129 GQNLCGVDRRRNWDLNVTNLVEQSM-GLWFGEHKLIDSSYITDFKLTKDLEKY-----------G 181
            ....||           .||...|. ..|....:.:.|.|        |..:|           |
 Frog    88 ANITCG-----------ENLFMSSYPASWEEVIQSLHSEY--------DNFEYGVGAKAVGLVIG 133

  Fly   182 HFVETVLDRNTHVGCAMMRFTNP----QYPFLYIYNTACNYASVYAIGVPVYNAGKPASECRTG- 241
            |:.:.:..::..:||......|.    :|.::..|..|.|||.  .|..| |.:|...::|... 
 Frog   134 HYTQVMWYKSYRIGCYCTECPNDGVRLKYYYVCQYYPAGNYAD--RINYP-YKSGPSCADCPDAC 195

  Fly   242 -----SNPEYPALCSIKEQYN 257
                 :||     |..::||:
 Frog   196 DNGLCTNP-----CPYEDQYS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 37/170 (22%)
crisp1.7NP_989314.1 CAP_CRISP 32..171 CDD:349402 35/166 (21%)
Crisp 188..243 CDD:369954 6/29 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.