DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and crispld1b

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_009296842.1 Gene:crispld1b / 393442 ZFINID:ZDB-GENE-040426-1204 Length:509 Species:Danio rerio


Alignment Length:212 Identity:57/212 - (26%)
Similarity:75/212 - (35%) Gaps:65/212 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 KLIVNEHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNLG 129
            :||::.|||.|..:       |.||:.|..||||.|||..|.....||..||...|...|   :|
Zfish    64 QLILDLHNKLRGQV-------YPPASNMEYMVWDTELERSAEHWAHTCLWEHGPSHLLTR---IG 118

  Fly   130 QNL---CGVDRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLE-----KY------ 180
            |||   .|.||...:.:..          |:.|        :.||......|     .|      
Zfish   119 QNLGAHWGRDRPPTFHVQA----------WYDE--------VRDFSYPYPQECNPHCPYRCSGPV 165

  Fly   181 -GHFVETVLDRNTHVGCAMMRFTNPQYPF----------LYIYNTACNYASV-YAIGVPVYNAGK 233
             .|:.:.|...:..:|||:    |..|..          :|:   .|||:.. ...|...|..|.
Zfish   166 CTHYTQLVWATSNKIGCAI----NVCYNMNVWGMIWAKAVYL---VCNYSPPGNWWGHAPYKHGT 223

  Fly   234 PASECRTGSNPEYPALC 250
            |.|.|    .|.|...|
Zfish   224 PCSAC----PPSYGGGC 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 47/178 (26%)
crispld1bXP_009296842.1 SCP_euk 64..208 CDD:240180 47/178 (26%)
LCCL 301..385 CDD:128866
LCCL 404..501 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585726
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.