DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and CG8072

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster


Alignment Length:276 Identity:75/276 - (27%)
Similarity:109/276 - (39%) Gaps:68/276 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RFQTVGCLLIILGMASSQPLSWCDPDLCPDNTVHIACNNDGKFHESCSPDATMVDLKPYRKLIVN 69
            |.|....|..||.:.|...:.:||...|.... ||.|:|:..|.|||.....:|::..:|:.::.
  Fly     3 RLQLTLFLCKILFLRSILAIDFCDIKSCHGKR-HIGCDNNMMFDESCLRFHGLVNMAYFREYLLG 66

  Fly    70 EHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLE--HDDC---------HNSY 123
            .||..|..:||.......||.:|..:|||..|..:|..:||.|.::  .|.|         |.:|
  Fly    67 LHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDFSEPHFNY 131

  Fly   124 ----------RFRNLGQNLCGVDRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLE 178
                      |..|:.:              :|.|.||    |      :|..|..|     |:.
  Fly   132 AEDFYPRPVIRQSNVRE--------------MTILAEQ----W------LDELYDLD-----DIA 167

  Fly   179 KY---GHFVETVLDRNTHVGCAMMRFTNPQYPFLYI-YNTACNYASVYAIGVPV----YNAG-KP 234
            .|   |.....:.||::::|||    ....|....| :...|.|:|    |.||    |..| ..
  Fly   168 TYSAEGEIRNIINDRSSYMGCA----AGQDYDLWNIHFVLVCYYSS----GPPVEGNLYEEGIFN 224

  Fly   235 ASECRTGSNPEYPALC 250
            |:.|..|.:.|||.||
  Fly   225 ATLCPNGQSDEYPNLC 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 42/179 (23%)
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 42/179 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440639
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.