DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and Crisp2

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001011710.1 Gene:Crisp2 / 360445 RGDID:621653 Length:243 Species:Rattus norvegicus


Alignment Length:197 Identity:44/197 - (22%)
Similarity:72/197 - (36%) Gaps:32/197 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 ESCSPD-ATMV--DLKPYRKLIVNEHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLK 110
            |...|| ||:.  .::..|::|. :||:.|..::.       |.:.:..|.|:.:....|.....
  Rat    21 EGKDPDFATLTTNQIQVQREIIA-KHNELRRQVSP-------PGSNILKMEWNVQAAANAQKWAN 77

  Fly   111 TCYLEHDDCHNSYRFRNLGQNLCGVDRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTK 175
            .|.|||....:.......|:||.......:|...:.:..|::....||..             .|
  Rat    78 NCILEHSSTEDRKINIKCGENLYMSTDPTSWRTVIQSWYEENENFVFGVG-------------AK 129

  Fly   176 DLEKYGHFVETVLDRNTHVGCAMMRFTNPQYPFLYIYNTACNYA----SVYAIGVPVYNAGKPAS 236
            .....||:.:.|...:..|||.:....| |....|.|  .|:|.    :|.....| |:.|.|.:
  Rat   130 PNSAVGHYTQLVWYSSFKVGCGVAYCPN-QDTLKYFY--VCHYCPMGNNVMKKSTP-YHQGTPCA 190

  Fly   237 EC 238
            .|
  Rat   191 SC 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 32/154 (21%)
Crisp2NP_001011710.1 CAP_CRISP 36..172 CDD:349402 33/159 (21%)
Crisp 189..243 CDD:400739 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344752
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.