DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and CG32313

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster


Alignment Length:158 Identity:38/158 - (24%)
Similarity:59/158 - (37%) Gaps:54/158 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 RKLIVNEHNKRR-NYIASGSLPGYYPATRMATMVWDEEL-----EY---------LATLNLKTCY 113
            |.||:..||:|| .|   |:.|          ||.||||     ||         :.|.|    |
  Fly    24 RSLILEAHNRRRAKY---GNQP----------MVLDEELCTECSEYADEIVRNEGVYTEN----Y 71

  Fly   114 LEHDDCHNSYRFRNLGQNLCGVDRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLE 178
            ||:....:....::| |.:| |.|..        |..:.:.:||......:::            
  Fly    72 LEYLYATDPISAKHL-QVVC-VFREA--------LPRECVRIWFHYRGFAENT------------ 114

  Fly   179 KYGHFVETVLDRNTHVGCAMMRFTNPQY 206
            ||..|...:.:.:|.:|..:.|....:|
  Fly   115 KYYRFTAMIWNASTRLGVGLGRIQETRY 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 38/158 (24%)
CG32313NP_001261262.1 SCP 27..153 CDD:294090 36/155 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455174
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.