DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and Crispld1

DIOPT Version :10

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001128435.1 Gene:Crispld1 / 316482 RGDID:1564813 Length:500 Species:Rattus norvegicus


Alignment Length:194 Identity:52/194 - (26%)
Similarity:75/194 - (38%) Gaps:53/194 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 IVNEHNKRRNYIASGSLPGYYP-ATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNLGQ 130
            |::.|||.|:.:        || |:.|..|.||.|||..|....:||..||..   :....::||
  Rat    65 ILDLHNKLRSQV--------YPAASNMEYMTWDVELERSAESWAETCLWEHGP---TSLLPSIGQ 118

  Fly   131 NLCGV--DRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKY----------GHF 183
            || |.  .|.|....:|.        .|:.|.:  |.||    ....:.:.|          .|:
  Rat   119 NL-GAHWGRYRPPTFHVQ--------AWYDEVR--DFSY----PYEHECDPYCPFRCSGPVCTHY 168

  Fly   184 VETVLDRNTHVGCAMMRFTN--------PQYPFLYIYNTACNYA-SVYAIGVPVYNAGKPASEC 238
            .:.|...::.:|||:....|        |:..:|     .|||: .....|...|..|||.|.|
  Rat   169 TQVVWATSSRIGCAINLCHNMNIWGQIWPKAVYL-----VCNYSPKGNWWGHAPYKHGKPCSAC 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 CAP_euk 64..219 CDD:349399 44/172 (26%)
Crispld1NP_001128435.1 CAP_CRISPLD1 62..207 CDD:349407 44/172 (26%)
LCCL 291..375 CDD:128866
LCCL 394..491 CDD:427521
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.