DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and CLEC18C

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_775890.2 Gene:CLEC18C / 283971 HGNCID:28538 Length:446 Species:Homo sapiens


Alignment Length:289 Identity:55/289 - (19%)
Similarity:92/289 - (31%) Gaps:90/289 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GRFQTVGCLLIILGMASSQPLSWCD---PDLCPDNTVHIACNNDGKFHESCSPDATMVDLKPYRK 65
            ||...:..||.:||.|      |.:   |.|.....:..|.|....|                  
Human     9 GRGHLLAVLLALLGTA------WAEVWPPQLQEQAPMAGALNRKESF------------------ 49

  Fly    66 LIVNEHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNS-YRFRNLG 129
            |:::.||:.|:::..       ||..|..:.|.:.|..||......|.:......:. :|...:|
Human    50 LLLSLHNRLRSWVQP-------PAADMRRLDWSDSLAQLAQARAALCGIPTPSLASGLWRTLQVG 107

  Fly   130 QNLCGVDRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYG------------- 181
            .|:      :.....:.:.|| .:.|||.|.                 ::|.             
Human   108 WNM------QLLPAGLASFVE-VVSLWFAEG-----------------QRYSHAAGECARNATCT 148

  Fly   182 HFVETVLDRNTHVGCAMMRFTNPQ---YPFLYIYNTACNYASVYAIGVPVYNAGKPASECRTGSN 243
            |:.:.|...::.:||.....:..|   ..|:..|:...|: .|....:..|..|...|.|....:
Human   149 HYTQLVWATSSQLGCGRHLCSAGQAAIEAFVCAYSPRGNW-EVNGKTIVPYKKGAWCSLCTASVS 212

  Fly   244 PEYPA------LCSIKEQYNP------NH 260
            ..:.|      ||.:..  ||      ||
Human   213 GCFKAWDHAGGLCEVPR--NPCRMSCQNH 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 30/171 (18%)
CLEC18CNP_775890.2 SCP_euk 50..183 CDD:240180 28/163 (17%)
CLECT 310..434 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151085
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.