DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and GLIPR1L1

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_011536436.2 Gene:GLIPR1L1 / 256710 HGNCID:28392 Length:301 Species:Homo sapiens


Alignment Length:242 Identity:53/242 - (21%)
Similarity:89/242 - (36%) Gaps:72/242 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CL----LIILGMASSQPLSWCDPDLCPDNTVHIACNNDGKFHESCSPDATMVDLKPYRKLIVNEH 71
            ||    |.::...||:..|..||                .|.::|                :..|
Human    94 CLWILGLCLVATTSSKIPSITDP----------------HFIDNC----------------IEAH 126

  Fly    72 NKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDC-HNSYR----FRNLGQN 131
            |:.|..:..       ||..|..|:||:.|..:|......|..||:|| ..||:    |..:|:|
Human   127 NEWRGKVNP-------PAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGEN 184

  Fly   132 LCGVDRRRNWDLNVTNLV-EQSMGLWFGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRNTHVG 195
            :        |...:.:.. ..::..|:.|.:..|...::..::.      ||:.:.|...:.:||
Human   185 I--------WLGGIKSFTPRHAITAWYNETQFYDFDSLSCSRVC------GHYTQLVWANSFYVG 235

  Fly   196 CAMMRFTN----PQYPFLYIYNTACNYASVYAIGVPVYNAGKPASEC 238
            ||:....|    ....|:..|..|.|:|:     :|.|..|:..|.|
Human   236 CAVAMCPNLGGASTAIFVCNYGPAGNFAN-----MPPYVRGESCSLC 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 37/164 (23%)
GLIPR1L1XP_011536436.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151299
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5261
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.